IER5L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP174071

Catalog No. NBP174071

Description

IER5L Polyclonal specifically detects IER5L in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: IER5L
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: IER5L
• Immunogen: Synthetic peptides corresponding to the C terminal of Ier5l. Immunizing peptide sequence TPFAPCKRARFEDFCPDSSPDASNISNLISIFGSGFSGLVSRQPDSSEQP.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 389792
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: bA247A12.2, immediate early response 5-like, immediate early response gene 5-like protein, MGC70833
• Host Species: Rabbit
• Molecular Weight of Antigen: 47 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: .
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig
• Isotype: IgG