Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IER5L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | IER5L |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
IER5L Polyclonal specifically detects IER5L in Mouse samples. It is validated for Western Blot.Specifications
IER5L | |
Polyclonal | |
Rabbit | |
bA247A12.2, immediate early response 5-like, immediate early response gene 5-like protein, MGC70833 | |
IER5L | |
IgG | |
47 kDa |
Western Blot | |
Unconjugated | |
RUO | |
389792 | |
Synthetic peptides corresponding to the C terminal of Ier5l. Immunizing peptide sequence TPFAPCKRARFEDFCPDSSPDASNISNLISIFGSGFSGLVSRQPDSSEQP. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title