Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IER5L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17961020UL
Description
IER5L Polyclonal specifically detects IER5L in Human samples. It is validated for Western Blot.Specifications
IER5L | |
Polyclonal | |
Western Blot 1:1000 | |
NP_982258 | |
IER5L | |
Synthetic peptide directed towards the middle region of human IER5LThe immunogen for this antibody is IER5L. Peptide sequence SNLISIFGSGFSGLVSRQPDSSEQPPPLNGQLCAKQALASLGAWTRAIVA. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
bA247A12.2, immediate early response 5-like, immediate early response gene 5-like protein, MGC70833 | |
Rabbit | |
Affinity Purified | |
RUO | |
389792 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction