Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

IER5L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	IER5L
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP17961020 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP17961020UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP179610 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP179610	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

IER5L Polyclonal specifically detects IER5L in Human samples. It is validated for Western Blot.

Specifications

Antigen	IER5L
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	NP_982258
Gene ID (Entrez)	389792
Immunogen	Synthetic peptide directed towards the middle region of human IER5LThe immunogen for this antibody is IER5L. Peptide sequence SNLISIFGSGFSGLVSRQPDSSEQPPPLNGQLCAKQALASLGAWTRAIVA.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	bA247A12.2, immediate early response 5-like, immediate early response gene 5-like protein, MGC70833
Gene Symbols	IER5L
Isotype	IgG

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

IER5L Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents