Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IF3EI Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15692620UL
Description
IF3EI Polyclonal specifically detects IF3EI in Human samples. It is validated for Western Blot.Specifications
| IF3EI | |
| Polyclonal | |
| Western Blot 1:100-1:2000 | |
| Q9Y262 | |
| EIF3L | |
| Synthetic peptides corresponding to EIF3EIP(eukaryotic translation initiation factor 3, subunit E interacting protein) The peptide sequence was selected from the N terminal of EIF3EIP. Peptide sequence SYPADDYESEAAYDPYAYPSDYDMHTGDPKQDLAYER | |
| 20 μL | |
| Core ESC Like Genes, Stem Cell Markers | |
| 51386 | |
| Human | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| eIEF associated protein HSPC021, EIF3EIP, eIF3l, EIF3S11, EIF3S6IP, Eukaryotic translation initiation factor 3 subunit 6-interacting protein, Eukaryotic translation initiation factor 3 subunit E-interacting protein, eukaryotic translation initiation factor 3 subunit L, eukaryotic translation initiation factor 3, subunit 6 interacting protein, eukaryotic translation initiation factor 3, subunit L, HSPC021, HSPC025, MSTP005, subunit E interacting protein | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| This product is specific to Subunit or Isoform: L. | |
| Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction