IF3EI Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156926

Catalog No. NBP156926

Description

IF3EI Polyclonal specifically detects IF3EI in Human samples. It is validated for Western Blot.

Specifications

• Antigen: IF3EI
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: eIEF associated protein HSPC021, EIF3EIP, eIF3l, EIF3S11, EIF3S6IP, Eukaryotic translation initiation factor 3 subunit 6-interacting protein, Eukaryotic translation initiation factor 3 subunit E-interacting protein, eukaryotic translation initiation factor 3 subunit L, eukaryotic translation initiation factor 3, subunit 6 interacting protein, eukaryotic translation initiation factor 3, subunit L, HSPC021, HSPC025, MSTP005, subunit E interacting protein
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: L.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9Y262
• Gene Symbols: EIF3L
• Immunogen: Synthetic peptides corresponding to EIF3EIP(eukaryotic translation initiation factor 3, subunit E interacting protein) The peptide sequence was selected from the N terminal of EIF3EIP. Peptide sequence SYPADDYESEAAYDPYAYPSDYDMHTGDPKQDLAYERQYEQQTYQVIPEV The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 51386
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.