Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. IFI44 Antibody, Novus Biologicals™

IFI44 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15538020 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15538020 20 μL
NBP155380 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15538020 Supplier Novus Biologicals Supplier No. NBP15538020UL

Description

Rabbit Polyclonal Antibody

IFI44 Polyclonal specifically detects IFI44 in Human samples. It is validated for Western Blot.

Specifications

Antigen IFI44
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8TCB0
Gene Alias interferon-induced protein 44, interferon-induced, hepatitis C-associated microtubular aggregate protein(44kD), MTAP44p44Microtubule-associated protein 44, P44
Gene Symbols IFI44
Host Species Rabbit
Immunogen Synthetic peptides corresponding to IFI44(interferon-induced protein 44) The peptide sequence was selected from the middle region of IFI44. Peptide sequence LIEIERCEPVRSKLEEVQRKLGFALSDISVVSNYSSEWELDPVKDVLILS.
Molecular Weight of Antigen 50 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10561
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.