Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IFI44 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$158.00 - $499.50
Specifications
| Antigen | IFI44 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15538020
|
Novus Biologicals
NBP15538020UL |
20 μL |
Each for $158.00
|
|
|||||
|
NBP155380
|
Novus Biologicals
NBP155380 |
100 μL |
Each for $499.50
|
|
|||||
Description
IFI44 Polyclonal specifically detects IFI44 in Human samples. It is validated for Western Blot.Specifications
| IFI44 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| interferon-induced protein 44, interferon-induced, hepatitis C-associated microtubular aggregate protein(44kD), MTAP44p44Microtubule-associated protein 44, P44 | |
| IFI44 | |
| IgG | |
| 50 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8TCB0 | |
| 10561 | |
| Synthetic peptides corresponding to IFI44(interferon-induced protein 44) The peptide sequence was selected from the middle region of IFI44. Peptide sequence LIEIERCEPVRSKLEEVQRKLGFALSDISVVSNYSSEWELDPVKDVLILS. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title