IFN-alpha J1/IFNA7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179586

Catalog No. NBP179586

Description

IFN-alpha J1/IFNA7 Polyclonal specifically detects IFN-alpha J1/IFNA7 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: IFN-alpha J1/IFNA7
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: interferon alpha-7, interferon alpha-J1, interferon, alpha 7
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
• Target Species: Human, Mouse, Guinea Pig
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_066401
• Gene Symbols: IFNA7
• Immunogen: Synthetic peptide directed towards the N terminal of human IFNA7The immunogen for this antibody is IFNA7. Peptide sequence RALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQFQKTQAISVLHEMIQ.
• Quantity: 100 μL
• Research Discipline: Cytokine Research, Immunology
• Gene ID (Entrez): 3444
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.