Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Ift80 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Ift80 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Ift80 Polyclonal specifically detects Ift80 in Mouse samples. It is validated for Western Blot.Specifications
Ift80 | |
Polyclonal | |
Rabbit | |
Q8K057 | |
57560 | |
Synthetic peptides corresponding to the C terminal of Ift80. Immunizing peptide sequence PNTIYVDRDILPKTLYERDASEYSKNPHIVSFVGNQVTIRRADGSLVHIS. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
ATD2, intraflagellar transport 80 homolog (Chlamydomonas), intraflagellar transport protein 80 homolog, KIAA1374WDR56WD repeat domain 56, MGC126543, WD repeat-containing protein 56 | |
IFT80 | |
IgG | |
85 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title