IGF2BP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP236473

Catalog No. NBP236473

Description

IGF2BP1 Polyclonal specifically detects IGF2BP1 in Mouse, Rat samples. It is validated for Western Blot.

Specifications

• Antigen: IGF2BP1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: IGF2BP1
• Immunogen: Synthetic peptide of Igf2bp1 Peptide sequence PQLRWEVLDSLLAQYGTVENCEQVNTESETAVVNVTYSNREQTRQAIMKL The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10642
• Target Species: Mouse, Rat, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: Coding region determinant-binding protein, CRD-BP, CRDBPIGF-II mRNA-binding protein 1, IGF II mRNA binding protein 1, IMP1, IMP-1ZBP-1, insulin-like growth factor 2 mRNA binding protein 1, insulin-like growth factor 2 mRNA-binding protein 1, VICKZ family member 1, VICKZ1, ZBP1IGF2 mRNA-binding protein 1, Zip code-binding protein 1, Zipcode-binding protein 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 63 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Add 50μL of distilled water. Final anti-Igf2bp1 antibody concentration is 1mg/mL in PBS buffer with 2% sucrose.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.