Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. IGF2BP3 Antibody, Novus Biologicals™

IGF2BP3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP1689820 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP1689820 20 μL
NBP168981 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP1689820 Supplier Novus Biologicals Supplier No. NBP16898120UL

Description

Rabbit Polyclonal Antibody

IGF2BP3 Polyclonal specifically detects IGF2BP3 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen IGF2BP3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. Q9CPN8
Gene Alias CT98, hKOC, IGF II mRNA binding protein 3, IGF2 mRNA-binding protein 3, IGF-II mRNA-binding protein 3, IMP-3KH domain-containing protein overexpressed in cancer, IMP3VICKZ family member 3, insulin-like growth factor 2 mRNA binding protein 3, insulin-like growth factor 2 mRNA-binding protein 3, KH domain containing protein overexpressed in cancer, KOC1DKFZp686F1078, VICKZ3cancer/testis antigen 98
Gene Symbols IGF2BP3
Host Species Rabbit
Immunogen Synthetic peptides corresponding to Igf2bp3 (insulin-like growth factor 2 mRNA binding protein 3) The peptide sequence was selected from the middle region of Igf2bp3 (NP_076159). Peptide sequence QQNPSPQLRGRRGPGQRGSSRQASPGSVSKQKPCDLPLRLLVPTQFVGAI.
Molecular Weight of Antigen 63 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10643
Target Species Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.