IGFBP-1 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP233599	0.1 mL
NB436824	25 μL

Catalog No. NBP233599 Supplier Novus Biologicals Supplier No. NBP233599

Description

Rabbit Polyclonal Antibody

IGFBP-1 Polyclonal specifically detects IGFBP-1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: IGFBP-1
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:5000 - 1:10000
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Accession No.: P08833
• Gene Alias: alpha-pregnancy-associated endometrial globulin, amniotic fluid binding protein, binding protein-25, binding protein-26, binding protein-28, growth hormone independent-binding protein, hIGFBP-1, IBP1, IBP-1, IGF-binding protein 1, IGFBP-1, IGF-BP25, insulin-like growth factor binding protein 1, insulin-like growth factor-binding protein 1, Placental protein 12, PP12AFBP
• Gene Symbols: IGFBP1
• Host Species: Rabbit
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQI
• Purification Method: Affinity Purified
• Quantity: 0.1 mL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3484
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Target Species: Human
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only