Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. IGHMBP2 Antibody, Novus Biologicals™

IGHMBP2 Antibody, Novus Biologicals™
SDP

Catalog No. NB16901120 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB16901120 20 μL
NBP168921 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB16901120 Supplier Novus Biologicals Supplier No. NBP16892120UL

Description

Rabbit Polyclonal Antibody

IGHMBP2 Polyclonal specifically detects IGHMBP2 in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

Antigen IGHMBP2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. P40694
Gene Alias ATP-dependent helicase IGHMBP2, CATF1FLJ41171, EC 3.6.1, EC 3.6.4.12, EC 3.6.4.13, GF-1, Glial factor 1, HCSA, HMN6cardiac transcription factor 1, immunoglobulin mu binding protein 2, Immunoglobulin mu-binding protein 2, SMARD1DNA-binding protein SMUBP-2, SMBP2, SMUBP2FLJ34220
Gene Symbols IGHMBP2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to Ighmbp2 (immunoglobulin mu binding protein 2) The peptide sequence was selected from the N terminal of Ighmbp2. Peptide sequence QLLELERDAEVEERRSWQEHSSLRELQSRGVCLLKLQVSSQRTGLYGQRL.
Molecular Weight of Antigen 109 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3508
Target Species Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.