IGHMBP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP16892120UL

Catalog No. NB16901120

Description

IGHMBP2 Polyclonal specifically detects IGHMBP2 in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: IGHMBP2
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Accession No.: P40694
• Gene Symbols: IGHMBP2
• Immunogen: Synthetic peptides corresponding to Ighmbp2 (immunoglobulin mu binding protein 2) The peptide sequence was selected from the N terminal of Ighmbp2. Peptide sequence QLLELERDAEVEERRSWQEHSSLRELQSRGVCLLKLQVSSQRTGLYGQRL.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3508
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with No Preservative
• Gene Alias: ATP-dependent helicase IGHMBP2, CATF1FLJ41171, EC 3.6.1, EC 3.6.4.12, EC 3.6.4.13, GF-1, Glial factor 1, HCSA, HMN6cardiac transcription factor 1, immunoglobulin mu binding protein 2, Immunoglobulin mu-binding protein 2, SMARD1DNA-binding protein SMUBP-2, SMBP2, SMUBP2FLJ34220
• Host Species: Rabbit
• Molecular Weight of Antigen: 109 kDa
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Mouse
• Isotype: IgG