IGHMBP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP168921

Catalog No. NBP168921

Description

IGHMBP2 Polyclonal specifically detects IGHMBP2 in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: IGHMBP2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ATP-dependent helicase IGHMBP2, CATF1FLJ41171, EC 3.6.1, EC 3.6.4.12, EC 3.6.4.13, GF-1, Glial factor 1, HCSA, HMN6cardiac transcription factor 1, immunoglobulin mu binding protein 2, Immunoglobulin mu-binding protein 2, SMARD1DNA-binding protein SMUBP-2, SMBP2, SMUBP2FLJ34220
• Host Species: Rabbit
• Molecular Weight of Antigen: 109 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunocytochemistry/Immunofluorescence
• Gene Accession No.: P40694
• Gene Symbols: IGHMBP2
• Immunogen: Synthetic peptides corresponding to Ighmbp2 (immunoglobulin mu binding protein 2). The peptide sequence was selected from the N terminal of Ighmbp2. Peptide sequence QLLELERDAEVEERRSWQEHSSLRELQSRGVCLLKLQVSSQRTGLYGQRL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3508
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig
• Isotype: IgG