IL-11R alpha Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP162351

Catalog No. NBP162351

Description

IL-11R alpha Polyclonal specifically detects IL-11R alpha in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: IL-11R alpha
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: IL-11 receptor subunit alpha, IL-11R subunit alpha, IL-11RA, IL-11R-alpha, interleukin 11 receptor, alpha, interleukin-11 receptor alpha chain, interleukin-11 receptor subunit alpha, MGC2146
• Host Species: Rabbit
• Molecular Weight of Antigen: 43 kDa
• Quantity: 100 μL
• Research Discipline: Cytokine Research, Immunology, Innate Immunity
• Gene ID (Entrez): 3590
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
• Gene Accession No.: Q14626
• Gene Symbols: IL11RA
• Immunogen: Synthetic peptides corresponding to IL11RA(interleukin 11 receptor, alpha) The peptide sequence was selected from the middle region of IL11RA. Peptide sequence FLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLDA.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: alpha.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

For Research Use Only