Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

IL-17RE Antibody (46N7E3), Janelia Fluor™ 646, Novus Biologicals™
SDP

Catalog No. N227367J646 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
N227367J646 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. N227367J646 Supplier Novus Biologicals Supplier No. NBP227367JF646
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

IL-17RE Monoclonal specifically detects IL-17RE in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen IL-17RE
Applications Western Blot, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone 46N7E3
Conjugate Janelia Fluor 646
Dilution Western Blot, Immunohistochemistry-Paraffin
Formulation 50mM Sodium Borate with 0.05% Sodium Azide
Gene Alias IL-17 receptor E, interleukin 17 receptor E
Gene Symbols IL17RE
Host Species Mouse
Immunogen amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR∽TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE
Purification Method Protein G purified
Quantity 0.1 mL
Primary or Secondary Primary
Gene ID (Entrez) 132014.0
Target Species Human
Content And Storage Store at 4°C in the dark.
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.