Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

IL-17RE Antibody (46N8G7), DyLight 755, Novus Biologicals™
SDP

Catalog No. NBP227366IR Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP227366IR 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP227366IR Supplier Novus Biologicals Supplier No. NBP227366IR
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

IL-17RE Monoclonal specifically detects IL-17RE in Human samples. It is validated for Western Blot.

Specifications

Antigen IL-17RE
Applications Western Blot
Classification Monoclonal
Clone 46N8G7
Conjugate DyLight 755
Dilution Western Blot
Gene Accession No. Q8NFR9
Gene Alias IL-17 receptor E, interleukin 17 receptor E
Gene Symbols IL17RE
Host Species Mouse
Immunogen amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR∼TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE
Purification Method Protein G purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 132014
Target Species Human
Content And Storage Store at 4C in the dark.
Form Purified
Isotype IgG1 κ
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.