IL-22BP/IL22 RA2 Goat anti-Human, Mouse, Rat, Polyclonal, Novus Biologicals™

Goat Polyclonal Antibody

Supplier:  Novus Biologicals NB1007420.025MG

Catalog No. NB017812

Description

IL-22BP/IL22 RA2 Polyclonal specifically detects IL-22BP/IL22 RA2 in Human, Mouse, Rat samples. It is validated for ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: IL-22BP/IL22 RA2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: 10mM KHPO4 and 0.14M NaCl, pH 7.2 with 0.1% Sodium Azide
• Gene Alias: class II cytokine receptor, CRF2-10, CRF2-S1IL22BP, Cytokine receptor class-II member 10, Cytokine receptor family 2 member 10, Cytokine receptor family type 2, soluble 1, IL-22 receptor subunit alpha-2, IL-22BPCRF2X, IL-22RA2, IL-22R-alpha-2, interleukin 22 receptor, alpha 2, interleukin 22-binding protein, interleukin-22 receptor subunit alpha-2, Interleukin-22-binding protein, MGC150509, MGC150510, zcytoR16
• Host Species: Goat
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: IL22 RA2
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry (Paraffin), Immunohistochemistry, ELISA
• Concentration: 1.0 mg/mL
• Dilution: ELISA 1:50000, Immunohistochemistry 1:150, Immunohistochemistry-Paraffin 1:150
• Gene Accession No.: Q969J5
• Gene Symbols: IL22RA2
• Immunogen: Synthetic peptide RVQFQSRNFHNILQWQPGRALTGNSSVY-C corresponding to 33-60 residues of N-terminus of human IL-22R-alpha-2 protein with cysteine added for conjugation to a carrier protein.
• Quantity: 0.025 mg
• Research Discipline: Cytokine Research, Immunology, Signal Transduction
• Gene ID (Entrez): 116379
• Target Species: Mouse, Rat, Human
• Isotype: IgG

For Research Use Only