Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IL-28R alpha/IFN-lambda R1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications
Supplier: Novus Biologicals NBP184381
Description
IL-28R alpha/IFN-lambda R1 Polyclonal specifically detects IL-28R alpha/IFN-lambda R1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
IL-28R alpha/IFN-lambda R1 | |
Polyclonal | |
Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Q8IU57 | |
IFNLR1 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:FEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEVPEAN | |
0.1 mL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
class II cytokine receptor CRF2/12, CRF2/12, CRF2-12, Cytokine receptor class-II member 12, Cytokine receptor family 2 member 12, IFN-lambda receptor 1, IFN-lambda-R1, IFNLR, IFNLR1, IL-28 receptor subunit alpha, IL-28R1, IL-28RA, IL-28R-alpha, Interferon lambda receptor 1, interferon lambda, receptor 1, interleukin 28 receptor A, interleukin 28 receptor, alpha, interleukin 28 receptor, alpha (interferon, lambda receptor), interleukin or cytokine receptor 2, interleukin-28 receptor subunit alpha, LICR2, Likely interleukin or cytokine receptor 2 | |
Rabbit | |
Affinity Purified | |
RUO | |
163702 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction