Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IL-28R alpha/IFN-lambda R1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications
$382.00 - $646.00
Specifications
Antigen | IL-28R alpha/IFN-lambda R1 |
---|---|
Dilution | Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
IL-28R alpha/IFN-lambda R1 Polyclonal specifically detects IL-28R alpha/IFN-lambda R1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
IL-28R alpha/IFN-lambda R1 | |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
class II cytokine receptor CRF2/12, CRF2/12, CRF2-12, Cytokine receptor class-II member 12, Cytokine receptor family 2 member 12, IFN-lambda receptor 1, IFN-lambda-R1, IFNLR, IFNLR1, IL-28 receptor subunit alpha, IL-28R1, IL-28RA, IL-28R-alpha, Interferon lambda receptor 1, interferon lambda, receptor 1, interleukin 28 receptor A, interleukin 28 receptor, alpha, interleukin 28 receptor, alpha (interferon, lambda receptor), interleukin or cytokine receptor 2, interleukin-28 receptor subunit alpha, LICR2, Likely interleukin or cytokine receptor 2 | |
IFNLR1 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Polyclonal | |
Rabbit | |
Human | |
Q8IU57 | |
163702 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:FEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEVPEAN | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title