Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

IL-28R alpha/IFN-lambda R1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP169635 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP169635 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP169635 Supplier Novus Biologicals Supplier No. NBP169635
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

IL-28R alpha/IFN-lambda R1 Polyclonal specifically detects IL-28R alpha/IFN-lambda R1 in Human samples. It is validated for Western Blot.

Specifications

Antigen IL-28R alpha/IFN-lambda R1
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q5VTX8
Gene Alias class II cytokine receptor CRF2/12, CRF2/12, CRF2-12, Cytokine receptor class-II member 12, Cytokine receptor family 2 member 12, IFN-lambda receptor 1, IFN-lambda-R1, IFNLR, IFNLR1, IL-28 receptor subunit alpha, IL-28R1, IL-28RA, IL-28R-alpha, Interferon lambda receptor 1, interferon lambda, receptor 1, interleukin 28 receptor A, interleukin 28 receptor, alpha, interleukin 28 receptor, alpha (interferon, lambda receptor), interleukin or cytokine receptor 2, interleukin-28 receptor subunit alpha, LICR2, Likely interleukin or cytokine receptor 2
Gene Symbols IFNLR1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to IL28RA(interleukin 28 receptor, alpha (interferon, lambda receptor)) The peptide sequence was selected from the N terminal of IL28RA. Peptide sequence EECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLF.
Molecular Weight of Antigen 54 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Apoptosis, Cytokine Research
Primary or Secondary Primary
Gene ID (Entrez) 163702
Test Specificity This product is specific to Subunit or Isoform: alpha.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.