Learn More
Description
Specifications
Specifications
| Antigen | IL-5 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.2-1 ug/ml |
| Formulation | PBS and 2% Sucrose with 0.09% Sodium Azide |
| Gene Alias | B-cell differentiation factor I, EDF, Eosinophil differentiation factor, IL-5T-cell replacing factor, interleukin 5 (colony-stimulating factor, eosinophil), interleukin-5, TRFB cell differentiation factor I |
| Gene Symbols | IL5 |
| Host Species | Rabbit |
| Immunogen | Synthetic peptides corresponding to Il5 (interleukin 5) The peptide sequence was selected from the middle region of Il5. Peptide sequence MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGL. |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
