Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IL-5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16916320UL
Description
IL-5 Polyclonal specifically detects IL-5 in Mouse samples. It is validated for Western Blot.Specifications
IL-5 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
B-cell differentiation factor I, EDF, Eosinophil differentiation factor, IL-5T-cell replacing factor, interleukin 5 (colony-stimulating factor, eosinophil), interleukin-5, TRFB cell differentiation factor I | |
Rabbit | |
15 kDa | |
20 μL | |
Primary | |
Mouse | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
IL5 | |
Synthetic peptides corresponding to Il5 (interleukin 5) The peptide sequence was selected from the middle region of Il5. Peptide sequence MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGL. | |
Affinity Purified | |
RUO | |
3567 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction