IL1RAPL2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18159825UL

Catalog No. NB433797

Description

IL1RAPL2 Polyclonal specifically detects IL1RAPL2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: IL1RAPL2
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: IL-1R-9, IL1R9IL-1 receptor accessory protein-like 2, IL-1R9IL-1RAPL-2, IL-1-RAPL-2, IL1RAPL-2IL1RAPL-2-related protein, interleukin 1 receptor 9, interleukin 1 receptor accessory protein-like 2, Three immunoglobulin domain-containing IL-1 receptor-related 1, TIGIRR-1Interleukin-1 receptor 9, X-linked interleukin-1 receptor accessory protein-like 2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 26280
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: IL1RAPL2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:TTELKVTALLTDKPPKPLFPMENQPSVIDVQLGKPLNIPCKAFFGFSGESGPMIYWMKGEKFIEELAGHIREGEIRLL
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only