IL1RAPL2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB433797	Novus Biologicals NBP18159825UL	25 μL
NBP181598	Novus Biologicals NBP181598	0.1 mL

Description

IL1RAPL2 Polyclonal specifically detects IL1RAPL2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: IL1RAPL2
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 26280
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:TTELKVTALLTDKPPKPLFPMENQPSVIDVQLGKPLNIPCKAFFGFSGESGPMIYWMKGEKFIEELAGHIREGEIRLL
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: IL-1R-9, IL1R9IL-1 receptor accessory protein-like 2, IL-1R9IL-1RAPL-2, IL-1-RAPL-2, IL1RAPL-2IL1RAPL-2-related protein, interleukin 1 receptor 9, interleukin 1 receptor accessory protein-like 2, Three immunoglobulin domain-containing IL-1 receptor-related 1, TIGIRR-1Interleukin-1 receptor 9, X-linked interleukin-1 receptor accessory protein-like 2
• Gene Symbols: IL1RAPL2
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only