ILDR1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169697

Catalog No. NBP169697

Description

ILDR1 Polyclonal specifically detects ILDR1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ILDR1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: autosomal recessive 42, ILDR1alpha, ILDR1alpha', ILDR1beta, immunoglobulin-like domain containing receptor 1, immunoglobulin-like domain-containing receptor 1 alpha, immunoglobulin-like domain-containing receptor 1 alpha', immunoglobulin-like domain-containing receptor 1 beta
• Host Species: Rabbit
• Molecular Weight of Antigen: 58 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Equine: 86%; Mouse: 86%; Rat: 79%.
• Target Species: Human, Mouse, Rat, Equine, Guinea Pig
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q86SU0-2
• Gene Symbols: ILDR1
• Immunogen: Synthetic peptides corresponding to ILDR1(immunoglobulin-like domain containing receptor 1) The peptide sequence was selected from the middle region of ILDR1. Peptide sequence RRGSHSPHWPEEKPPSYRSLDITPGKNSRKKGSVERRSEKDSSHSGRSVV.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 286676
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only