Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ILF1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP31772525UL
This item is not returnable.
View return policy
Description
ILF1 Polyclonal antibody specifically detects ILF1 in Human samples. It is validated for ImmunofluorescenceSpecifications
| ILF1 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| Cellular transcription factor ILF-1, forkhead box K2, forkhead box protein K2, FOXK1, ILF-1, ILF1ILF, interleukin enhancer binding factor 1, Interleukin enhancer-binding factor 1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: GTHVASVPTAVHGQVNNAAASPLHMLATHASASASLPTKRHNGDQPEQPELKRIKTEDGEGIVIALSVDTPPAAVRE | |
| 25 μg | |
| Immunology, Innate Immunity | |
| 3607 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction