Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP158225

ILF3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP158225 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP158225 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP158225 Supplier Novus Biologicals Supplier No. NBP158225
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

ILF3 Polyclonal specifically detects ILF3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen ILF3
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q12906-2
Gene Alias Double-stranded RNA-binding protein 76, double-stranded RNA-binding protein, 76 kD, DRBF, DRBP76M-phase phosphoprotein 4, dsRNA binding protein NFAR-2/MPP4, interleukin enhancer binding factor 3, 90kDa, interleukin enhancer-binding factor 3, MPHOSPH4interleukin enhancer binding factor 3, 90kD, MPP4MMP4, NF90CBTF, NFAR-1, NFAR2, NFARNF110, NF-AT-90, Nuclear factor associated with dsRNA, Nuclear factor of activated T-cells 90 kDa, nuclear factor of activated T-cells, 90 kD, TCP110, TCP80, Translational control protein 80
Gene Symbols ILF3
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ILF3 (interleukin enhancer binding factor 3, 90kDa) The peptide sequence was selected from the N terminal of ILF3 (NP_004507). Peptide sequence PTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDD.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 3609
Test Specificity Expected identity based on immunogen sequence: Guinea pig: 100%; Human: 100%; Equine: 92%; Bovine: 85%; Canine: 85%; Rabbit: 84%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.