Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ILT3/CD85k/LILRB4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

ILT3/CD85k/LILRB4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB124791 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB124791 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB124791 Supplier Novus Biologicals Supplier No. NBP309945100UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

ILT3/CD85k/LILRB4 Polyclonal specifically detects ILT3/CD85k/LILRB4 in Human samples. It is validated for Western Blot.

Specifications

Antigen ILT3/CD85k/LILRB4
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias CD85 antigen-like family member K, CD85k, CD85k antigen, ILT-3, ILT3CD85K, leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), LIR5LILRB5, LIR-5subfamily B, member 4, member 4
Host Species Rabbit
Immunogen The immunogen for Anti-ILT3/CD85k/LILRB4 antibody is: synthetic peptide directed towards the C-terminal region of Human LIRB4. Peptide sequence RQGKHRTLAQRQADFQRPPGAAEPEPKDGGLQRRSSPAADVQGENFCAAV
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 11006
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.