ILT7/CD85g/LILRA4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP24893225UL

Catalog No. NB395926

Description

ILT7/CD85g/LILRA4 Polyclonal antibody specifically detects ILT7/CD85g/LILRA4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: ILT7/CD85g/LILRA4
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: CD85 antigen-like family member G, CD85g, CD85g antigen, ILT-7, ILT7MGC129598, Immunoglobulin-like transcript 7, leukocyte immunoglobulin-like receptor subfamily A member 4, leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 4, leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member4, MGC129597
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DHRLSWTLNSHQHNHGKFQALFPMGPLTFSNRGTFRCYGYENNTPYVWSEPSD
• Quantity: 25 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 23547
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG