Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ILT7/CD85g/LILRA4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00
Specifications
| Antigen | ILT7/CD85g/LILRA4 |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
ILT7/CD85g/LILRA4 Polyclonal antibody specifically detects ILT7/CD85g/LILRA4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| ILT7/CD85g/LILRA4 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| CD85 antigen-like family member G, CD85g, CD85g antigen, ILT-7, ILT7MGC129598, Immunoglobulin-like transcript 7, leukocyte immunoglobulin-like receptor subfamily A member 4, leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 4, leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member4, MGC129597 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: DHRLSWTLNSHQHNHGKFQALFPMGPLTFSNRGTFRCYGYENNTPYVWSEPSD | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2), 40% Glycerol | |
| 23547 | |
| IgG | |
| Immunogen affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title