IMP3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157229

Catalog No. NBP157229

Description

IMP3 Polyclonal specifically detects IMP3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: IMP3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: BRMS2mitochondrial ribosomal protein S4, C15orf12, chromosome 15 open reading frame 12, FLJ10968, IMP3, U3 small nucleolar ribonucleoprotein, homolog (yeast), MRPS4DKFZp586L0118, U3 small nucleolar ribonucleoprotein protein IMP3, U3 snoRNP protein 3 homolog, U3 snoRNP protein IMP3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Xenopus: 85%; Chicken: 81%; Zebrafish: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
• Gene Accession No.: Q9NV31
• Gene Symbols: IMP3
• Immunogen: Synthetic peptides corresponding to IMP3(IMP3, U3 small nucleolar ribonucleoprotein, homolog (yeast)) The peptide sequence was selected from the middle region of IMP3. Peptide sequence GHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLE.
• Quantity: 100 μL
• Research Discipline: DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 55272
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.