IMP3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25644125UL

Catalog No. NB435483

Description

IMP3 Polyclonal specifically detects IMP3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: IMP3
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: BRMS2mitochondrial ribosomal protein S4, C15orf12, chromosome 15 open reading frame 12, FLJ10968, IMP3, U3 small nucleolar ribonucleoprotein, homolog (yeast), MRPS4DKFZp586L0118, U3 small nucleolar ribonucleoprotein protein IMP3, U3 snoRNP protein 3 homolog, U3 snoRNP protein IMP3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: IMP3
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DFLNWEVTDHNLHELRVLRRYRLQRREDYTRYNQLSRAVRELARRLRDLPERDQFRVRASAALLDKLYALGLVPT
• Quantity: 25 μL
• Research Discipline: DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 55272
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only