IMPA2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154964

Catalog No. NBP154964

Description

IMPA2 Polyclonal specifically detects IMPA2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: IMPA2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 3.1.3.25, IMP 2, IMP.18P, IMPase 2, inosine monophosphatase 2, inositol monophosphatase 2, inositol monophosphatase 2 variant 1, inositol monophosphatase 2 variant 2, inositol(myo)-1(or 4)-monophosphatase 2, Inositol-1(or 4)-monophosphatase 2, Myo-inositol monophosphatase A2
• Host Species: Rabbit
• Molecular Weight of Antigen: 32 kDa
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 3613
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O14732
• Gene Symbols: IMPA2
• Immunogen: Synthetic peptides corresponding to IMPA2(inositol(myo)-1(or 4)-monophosphatase 2) The peptide sequence was selected from the middle region of IMPA2. Peptide sequence RGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLH.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Porcine: 86%; Guinea pig: 86%; Rat: 85%; Mouse: 85%; .
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG