IMPG2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP162656

Catalog No. NBP162656

Description

IMPG2 Polyclonal specifically detects IMPG2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: IMPG2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: interphotoreceptor matrix proteoglycan 2, interphotoreceptor matrix proteoglycan 200, Interphotoreceptor matrix proteoglycan of 200 kDa, IPM 200, IPM200SPACRCAN, RP56, Sialoprotein associated with cones and rods proteoglycan, Spacrcan
• Host Species: Rabbit
• Molecular Weight of Antigen: 138 kDa
• Quantity: 100 μL
• Research Discipline: Vision
• Gene ID (Entrez): 50939
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9BZV3
• Gene Symbols: IMPG2
• Immunogen: Synthetic peptides corresponding to IMPG2(interphotoreceptor matrix proteoglycan 2) The peptide sequence was selected from the C terminal of IMPG2. Peptide sequence VVFFSLRVTNMMFSEDLFNKNSLEYKALEQRFLELLVPYLQSNLTGFQNL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Zebrafish: 86%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG