Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

IMPG2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$499.50

Specifications

Antigen	IMPG2
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP162656 View Documents View Product Certificates	Novus Biologicals NBP162656	100 μL	Each of 1 for $499.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

IMPG2 Polyclonal specifically detects IMPG2 in Human samples. It is validated for Western Blot.

Specifications

Antigen	IMPG2
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Vision
Gene Alias	interphotoreceptor matrix proteoglycan 2, interphotoreceptor matrix proteoglycan 200, Interphotoreceptor matrix proteoglycan of 200 kDa, IPM 200, IPM200SPACRCAN, RP56, Sialoprotein associated with cones and rods proteoglycan, Spacrcan
Gene Symbols	IMPG2
Isotype	IgG
Molecular Weight of Antigen	138 kDa

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	Q9BZV3
Gene ID (Entrez)	50939
Immunogen	Synthetic peptides corresponding to IMPG2(interphotoreceptor matrix proteoglycan 2) The peptide sequence was selected from the C terminal of IMPG2. Peptide sequence VVFFSLRVTNMMFSEDLFNKNSLEYKALEQRFLELLVPYLQSNLTGFQNL.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

IMPG2 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents