Importin alpha 2/KPNA2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158067

Catalog No. NBP158067

Description

Importin alpha 2/KPNA2 Polyclonal specifically detects Importin alpha 2/KPNA2 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: Importin alpha 2/KPNA2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: importin alpha 1, importin-alpha-P1, IPOA1, karyopherin alpha 2 (RAG cohort 1, importin alpha 1), Karyopherin subunit alpha-2, pendulin, QIP2importin alpha 2, RAG cohort 1, RAG cohort protein 1, RCH1importin subunit alpha-2, SRP1, SRP1alpha, SRP1-alpha
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: alpha-2.
• Target Species: Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P52292
• Gene Symbols: KPNA2
• Immunogen: Synthetic peptides corresponding to KPNA2(karyopherin alpha 2 (RAG cohort 1, importin alpha 1)) The peptide sequence was selected from the middle region of KPNA2. Peptide sequence GTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ.
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication, Cellular Markers, Core ESC Like Genes, Immunology, Stem Cell Markers
• Gene ID (Entrez): 3838
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.