Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Importin alpha 2/KPNA2 Antibody, Novus Biologicals™

Importin alpha 2/KPNA2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15806720 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15806720 20 μL
NBP158067 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15806720 Supplier Novus Biologicals Supplier No. NBP15806720UL

Description

Rabbit Polyclonal Antibody

Importin alpha 2/KPNA2 Polyclonal specifically detects Importin alpha 2/KPNA2 in Human samples. It is validated for Western Blot.

Specifications

Antigen Importin alpha 2/KPNA2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P52292
Gene Alias importin alpha 1, importin-alpha-P1, IPOA1, karyopherin alpha 2 (RAG cohort 1, importin alpha 1), Karyopherin subunit alpha-2, pendulin, QIP2importin alpha 2, RAG cohort 1, RAG cohort protein 1, RCH1importin subunit alpha-2, SRP1, SRP1alpha, SRP1-alpha
Gene Symbols KPNA2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to KPNA2(karyopherin alpha 2 (RAG cohort 1, importin alpha 1)) The peptide sequence was selected from the middle region of KPNA2. Peptide sequence GTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Cell Cycle and Replication, Cellular Markers, Core ESC Like Genes, Immunology, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 3838
Test Specificity This product is specific to Subunit or Isoform: alpha-2.
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.