Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Importin alpha 5/KPNA1/SRP1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP154604 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP154604 100 μL
NBP15460420 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP154604 Supplier Novus Biologicals Supplier No. NBP154604
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Importin alpha 5/KPNA1/SRP1 Polyclonal specifically detects Importin alpha 5/KPNA1/SRP1 in Human, Mouse samples. It is validated for Western Blot.

Specifications

Antigen Importin alpha 5/KPNA1/SRP1
Applications Western Blot, Immunohistochemistry
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P52294
Gene Alias importin subunit alpha-1, importin-alpha-S1, IPOA5, karyopherin alpha 1 (importin alpha 5), Karyopherin subunit alpha-1, NPI-1SRP1importin alpha 5, Nucleoprotein interactor 1, RCH2RAG cohort protein 2, recombination activating gene cohort 2, SRP1-beta
Gene Symbols KPNA1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to KPNA1(karyopherin alpha 1 (importin alpha 5)) The peptide sequence was selected from the N terminal of KPNA1. Peptide sequence NMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVIS.
Molecular Weight of Antigen 60 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3836
Test Specificity This product is specific to Subunit or Isoform: alpha-1.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.