Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Importin alpha 5/KPNA1/SRP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $499.50
Specifications
| Antigen | Importin alpha 5/KPNA1/SRP1 |
|---|---|
| Applications | Western Blot, Immunohistochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15460420
|
Novus Biologicals
NBP15460420UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP154604
|
Novus Biologicals
NBP154604 |
100 μL |
Each for $499.50
|
|
|||||
Description
Importin alpha 5/KPNA1/SRP1 Polyclonal specifically detects Importin alpha 5/KPNA1/SRP1 in Human, Mouse samples. It is validated for Western Blot.Specifications
| Importin alpha 5/KPNA1/SRP1 | |
| Polyclonal | |
| Rabbit | |
| P52294 | |
| 3836 | |
| Synthetic peptides corresponding to KPNA1(karyopherin alpha 1 (importin alpha 5)) The peptide sequence was selected from the N terminal of KPNA1. Peptide sequence NMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVIS. | |
| Primary | |
| 60 kDa |
| Western Blot, Immunohistochemistry | |
| Unconjugated | |
| RUO | |
| importin subunit alpha-1, importin-alpha-S1, IPOA5, karyopherin alpha 1 (importin alpha 5), Karyopherin subunit alpha-1, NPI-1SRP1importin alpha 5, Nucleoprotein interactor 1, RCH2RAG cohort protein 2, recombination activating gene cohort 2, SRP1-beta | |
| KPNA1 | |
| IgG | |
| This product is specific to Subunit or Isoform: alpha-1. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title