Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Importin alpha 5/KPNA1/SRP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier: Novus Biologicals NBP15460420UL

View more versions of this product

Catalog No. NBP15460420

$206.00 / Each of 1

Already have an account? Sign In to view your price. New here? Register with us today!

Qty

Add to Cart

Description

Importin alpha 5/KPNA1/SRP1 Polyclonal specifically detects Importin alpha 5/KPNA1/SRP1 in Human samples. It is validated for Western Blot.

Specifications

Antigen	Importin alpha 5/KPNA1/SRP1
Classification	Polyclonal
Dilution	Western Blot 1:100-1:2000, Immunohistochemistry
Gene Accession No.	P52294
Gene Symbols	KPNA1
Immunogen	Synthetic peptides corresponding to KPNA1(karyopherin alpha 1 (importin alpha 5)) The peptide sequence was selected from the N terminal of KPNA1. Peptide sequence NMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVIS.
Purification Method	Affinity Purified
Regulatory Status	RUO
Gene ID (Entrez)	3836
Target Species	Human
Isotype	IgG

Applications	Western Blot, Immunohistochemistry
Conjugate	Unconjugated
Formulation	PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias	importin subunit alpha-1, importin-alpha-S1, IPOA5, karyopherin alpha 1 (importin alpha 5), Karyopherin subunit alpha-1, NPI-1SRP1importin alpha 5, Nucleoprotein interactor 1, RCH2RAG cohort protein 2, recombination activating gene cohort 2, SRP1-beta
Host Species	Rabbit
Molecular Weight of Antigen	60 kDa
Quantity	20 μL
Primary or Secondary	Primary
Test Specificity	This product is specific to Subunit or Isoform: alpha-1.
Content And Storage	Store at -20C. Avoid freeze-thaw cycles.

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Spot an opportunity for improvement?Share a Content Correction

Importin alpha 5/KPNA1/SRP1 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions