Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Indian Hedgehog/Ihh Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP159443
Description
Indian Hedgehog/Ihh Polyclonal specifically detects Indian Hedgehog/Ihh in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Indian Hedgehog/Ihh | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| BDA1Indian hedgehog homolog (Drosophila), HHG2, HHG-2, Indian hedgehog, Indian hedgehog (Drosophila) homolog, Indian hedgehog homolog, indian hedgehog protein | |
| Rabbit | |
| 45 kDa | |
| 100 μL | |
| Stem Cell Signaling Pathway | |
| 3549 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 1 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
| Q14623 | |
| IHH | |
| Synthetic peptides corresponding to IHH(Indian hedgehog homolog (Drosophila)) The peptide sequence was selected from the N terminal of IHH. Peptide sequence AAWGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIAR. | |
| Protein A purified | |
| RUO | |
| Primary | |
| Expected identity based on immunogen sequence: Goat: 86%; Horse: 86%; Bovine: 86%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction