Indian Hedgehog/Ihh Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159443

Catalog No. NBP159443

Description

Indian Hedgehog/Ihh Polyclonal specifically detects Indian Hedgehog/Ihh in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Indian Hedgehog/Ihh
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: BDA1Indian hedgehog homolog (Drosophila), HHG2, HHG-2, Indian hedgehog, Indian hedgehog (Drosophila) homolog, Indian hedgehog homolog, indian hedgehog protein
• Host Species: Rabbit
• Molecular Weight of Antigen: 45 kDa
• Quantity: 100 μL
• Research Discipline: Stem Cell Signaling Pathway
• Gene ID (Entrez): 3549
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q14623
• Gene Symbols: IHH
• Immunogen: Synthetic peptides corresponding to IHH(Indian hedgehog homolog (Drosophila)) The peptide sequence was selected from the N terminal of IHH. Peptide sequence AAWGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIAR.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Goat: 86%; Horse: 86%; Bovine: 86%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish
• Form: Purified

For Research Use Only