Inositol Monophosphatase 3/IMPAD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159473

Catalog No. NBP159473

Description

Inositol Monophosphatase 3/IMPAD1 Polyclonal specifically detects Inositol Monophosphatase 3/IMPAD1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Inositol Monophosphatase 3/IMPAD1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 3.1.3, EC 3.1.3.25, FLJ20421, IMP 3, IMPA3IMPase 3, inositol monophosphatase 3, inositol monophosphatase domain containing 1, Inositol monophosphatase domain-containing protein 1, Inositol-1(or 4)-monophosphatase 3, Myo-inositol monophosphatase A3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Human: 100%; Rabbit: 100%; Rat: 100%; Guinea pig: 92%; Chicken: 85%; Zebrafish: 84%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NX62
• Gene Symbols: IMPAD1
• Immunogen: Synthetic peptides corresponding to IMPAD1(inositol monophosphatase domain containing 1) The peptide sequence was selected from the N terminal of IMPAD1. Peptide sequence VLAAVRGGDEVRRVRESNVLHEKSKGKTREGAEDKMTSGDVLSNRKMFYL.
• Quantity: 100 μL
• Research Discipline: Protein Phosphatase
• Gene ID (Entrez): 54928
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.