Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Inositol Monophosphatase 3/IMPAD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Inositol Monophosphatase 3/IMPAD1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Inositol Monophosphatase 3/IMPAD1 Polyclonal specifically detects Inositol Monophosphatase 3/IMPAD1 in Human samples. It is validated for Western Blot.Specifications
Inositol Monophosphatase 3/IMPAD1 | |
Polyclonal | |
Rabbit | |
Protein Phosphatase | |
EC 3.1.3, EC 3.1.3.25, FLJ20421, IMP 3, IMPA3IMPase 3, inositol monophosphatase 3, inositol monophosphatase domain containing 1, Inositol monophosphatase domain-containing protein 1, Inositol-1(or 4)-monophosphatase 3, Myo-inositol monophosphatase A3 | |
IMPAD1 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
Q9NX62 | |
54928 | |
Synthetic peptides corresponding to IMPAD1(inositol monophosphatase domain containing 1) The peptide sequence was selected from the N terminal of IMPAD1. Peptide sequence VLAAVRGGDEVRRVRESNVLHEKSKGKTREGAEDKMTSGDVLSNRKMFYL. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title