Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Integrin alpha 2/CD49b Rabbit anti-Human, Mouse, Rat, Clone: 7O9H6, Novus Biologicals™

Integrin alpha 2/CD49b Rabbit anti-Human, Mouse, Rat, Clone: 7O9H6, Novus Biologicals™
SDP

Catalog No. NB166384 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB166384 20 μg
NB166383 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Catalog No. NB166384 Supplier Novus Biologicals Supplier No. NBP31564420UL
Add to Cart
Add to Cart
This item is not returnable. View return policy

Description

Rabbit Monoclonal Antibody

Integrin alpha 2/CD49b Monoclonal antibody specifically detects Integrin alpha 2/CD49b in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin), KnockDown

Specifications

Antigen Integrin alpha 2/CD49b
Applications Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin), KnockDown
Classification Monoclonal
Clone 7O9H6
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunoprecipitation 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200, Knockout Validated
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias alpha-2 subunit, CD49b antigen, integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor), VLA 2
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1082-1181 of human Integrin alpha 2/CD49b (P17301). GTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLMIMKPDEKAEVPTGVIIGSIIAGILLLLALVAILWKLGFFKRKYEKMTKNPDEIDETTELSS
Purification Method Affinity purified
Quantity 20 μg
Regulatory Status RUO
Research Discipline Cellular Markers, Innate Immunity, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 3673
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.