Integrin alpha 2b/CD41 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP184580

Catalog No. NBP184580

Description

Integrin alpha 2b/CD41 Polyclonal specifically detects Integrin alpha 2b/CD41 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Integrin alpha 2b/CD41
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: CD41, CD41 antigen, CD41BHPA3, GP2Bintegrin alpha-IIb, GPalpha IIb, GPIIb, GTA, integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigenCD41), integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigenCD41B), ITGAB, platelet fibrinogen receptor, alpha subunit, Platelet membrane glycoprotein IIb, platelet-specific antigen BAK
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3674
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: ITGA2B
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:FGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNV
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only