Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Integrin alpha 2b/CD41 Antibody, Novus Biologicals™
SDP

Catalog No. NBP184582 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP184582 0.1 mL
NB432536 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP184582 Supplier Novus Biologicals Supplier No. NBP184582
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Integrin alpha 2b/CD41 Polyclonal specifically detects Integrin alpha 2b/CD41 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Integrin alpha 2b/CD41
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias CD41, CD41 antigen, CD41BHPA3, GP2Bintegrin alpha-IIb, GPalpha IIb, GPIIb, GTA, integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigenCD41), integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigenCD41B), ITGAB, platelet fibrinogen receptor, alpha subunit, Platelet membrane glycoprotein IIb, platelet-specific antigen BAK
Gene Symbols ITGA2B
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVG
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3674
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.