Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Integrin alpha 3/CD49c Antibody (29A3), Alexa Fluor™ 647, Novus Biologicals™
SDP

Catalog No. NBP197692AH Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP197692AH 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP197692AH Supplier Novus Biologicals Supplier No. NBP197692AF647
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

Integrin alpha 3/CD49c Monoclonal specifically detects Integrin alpha 3/CD49c in Human, Porcine samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Frozen.

Specifications

Antigen Integrin alpha 3/CD49c
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Frozen)
Classification Monoclonal
Clone 29A3
Conjugate Alexa Fluor 647
Dilution Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Frozen
Formulation 50mM Sodium Borate with 0.05% Sodium Azide
Gene Alias antigen identified by monoclonal J143, CD49 antigen-like family member C, CD49c, CD49c antigen, FLJ34631, FLJ34704, FRP-2, Galactoprotein B3, GAP-B3, GAPB3CD49C, integrin alpha-3, integrin, alpha 3 (antigen CD49C, alpha 3 subunit of VLA-3 receptor), MSK18, VCA-2, very late activation protein 3 receptor, alpha-3 subunit, VL3A, VLA-3 subunit alpha, VLA3a
Gene Symbols ITGA3
Host Species Mouse
Immunogen Clone 29A3 is a mouse monoclonal IgG1, kappa antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.
Purification Method Protein A or G purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3675
Test Specificity 29A3 recognizes specifically the cytoplasmic domain of integrin subunit alpha3A. The monoclonal antibody reacts with Human tissues. A broader species reactivity is expected because of the conserved nature of the epitope.
Target Species Human, Pig
Content And Storage Store at 4C in the dark.
Form Purified
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.