Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP97732646

Integrin alpha 3B Antibody (54B3), Janelia Fluor™ 646, Novus Biologicals™
SDP

Catalog No. NBP97732646 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP97732646 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP97732646 Supplier Novus Biologicals Supplier No. NBP197732JF646
Add to Cart
Add to Cart

Description

Mouse Monoclonal Antibody

Integrin alpha 3B Monoclonal specifically detects Integrin alpha 3B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Frozen.

Specifications

Antigen Integrinalpha3B
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Frozen)
Classification Monoclonal
Clone 54B3
Conjugate Janelia Fluor 646
Dilution Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Frozen
Formulation 50mM Sodium Borate with 0.05% Sodium Azide
Gene Alias AA407068, CD49C, GAPB3, integrin alpha 3
Gene Symbols ITGA3
Host Species Mouse
Immunogen Clone 54B3 is a mouse monoclonal IgG1 antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin.
Purification Method Protein A or G purified
Quantity 0.1 mL
Primary or Secondary Primary
Gene ID (Entrez) 3675
Test Specificity 54B3 recognizes specifically the cytoplasmic domain of integrin subunit alpha3B. The monoclonal antibody reacts with Human tissues. A broader species reactivity is expected because of the conserved nature of the epitope.
Target Species Human
Content And Storage Store at 4°C in the dark.
Form Purified
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.