Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NB221109

Integrin alpha 3B Antibody (PB36), FITC, Novus Biologicals™
SDP

Catalog No. NB221109 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB221109 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB221109 Supplier Novus Biologicals Supplier No. NBP197731F
Add to Cart
Add to Cart

Description

Mouse Monoclonal Antibody

Integrin alpha 3B Monoclonal antibody specifically detects Integrin alpha 3B in Human samples. It is validated for Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Frozen)

Specifications

Antigen Integrin alpha 3B
Applications Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Frozen), Immunocytochemistry
Classification Monoclonal
Clone PB36
Conjugate FITC
Dilution Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Frozen
Formulation PBS
Gene Alias AA407068, CD49C, GAPB3, integrin alpha 3
Host Species Mouse
Immunogen Derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of Integrin alpha 3Bincluding an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin.
Purification Method Protein A or G purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Apoptosis
Primary or Secondary Primary
Gene ID (Entrez) 3675
Target Species Human, Mouse, Rat
Content And Storage Store at 4C in the dark.
Form Purified
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.